Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP

Structure of PDB 7f53 Chain R

Receptor sequence
>7f53R (length=273) Species: 9606 (Homo sapiens) [Search protein sequence]
GCYEQLFVSPEVFVTLGVISLLENILVIVAIAKNKNLHSPMYFFICSLAV
ADMLVSVSNGSETIVITLLNSTSFTVNIDNVIDSVICSSLLASICSLLSI
AVDRYFTIFYALQYHNIMTVKRVGIIISCIWAACTVSGILFIIYSDSSAV
IICLITMFFTMLALMASLYVHMFLMARLHIKRIAVLPGTQGANMKGAITL
TILIGVFVVCWAPFFLHLIFYISCPQNPYCVCFMSHFNLYLILIMCNSII
DPLIYALRSQELRKTFKEIICCY
3D structure
PDB7f53 Structural insights into ligand recognition and activation of the melanocortin-4 receptor.
ChainR
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide R E100 I104 V119 D122 D126 I129 C130 I185 S188 H264 Y268 M281 F284 N285 E62 I66 V76 D79 D83 I86 C87 I142 S145 H217 Y221 M234 F237 N238
BS02 CA R E100 D122 D126 E62 D79 D83
Gene Ontology
Molecular Function
GO:0004930 G protein-coupled receptor activity
GO:0004977 melanocortin receptor activity
GO:0004980 melanocyte-stimulating hormone receptor activity
GO:0005515 protein binding
GO:0017046 peptide hormone binding
GO:0031625 ubiquitin protein ligase binding
GO:0042562 hormone binding
GO:0042923 neuropeptide binding
Biological Process
GO:0002024 diet induced thermogenesis
GO:0006112 energy reserve metabolic process
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007188 adenylate cyclase-modulating G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007631 feeding behavior
GO:0019222 regulation of metabolic process
GO:0030073 insulin secretion
GO:0032868 response to insulin
GO:0045780 positive regulation of bone resorption
GO:0060259 regulation of feeding behavior
GO:1903925 response to bisphenol A
GO:1903998 regulation of eating behavior
GO:1990680 response to melanocyte-stimulating hormone
GO:2000252 negative regulation of feeding behavior
GO:2000821 regulation of grooming behavior
Cellular Component
GO:0005737 cytoplasm
GO:0005886 plasma membrane
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7f53, PDBe:7f53, PDBj:7f53
PDBsum7f53
PubMed34433901
UniProtP32245|MC4R_HUMAN Melanocortin receptor 4 (Gene Name=MC4R)

[Back to BioLiP]

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417