Structure of PDB 7qtt Chain Q

Receptor sequence
>7qttQ (length=100) Species: 9606 (Homo sapiens) [Search protein sequence]
SQLSKQYSSRDLPSHTKIKYRQTTQDAPEEVRNRDFRRELEERERAAARE
KNFKVKRRWDDDVVFKNCAKGVDDQKKDKRFVNDTLRSEFHKKFMEKYIK
3D structure
PDB7qtt Structural basis of catalytic activation in human splicing.
ChainQ
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna Q S31 R33 D34 S8 R10 D11
BS02 rna Q R33 P36 S37 H38 T39 R10 P13 S14 H15 T16
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0005515 protein binding
Biological Process
GO:0000398 mRNA splicing, via spliceosome
GO:0006397 mRNA processing
GO:0008380 RNA splicing
GO:0045292 mRNA cis splicing, via spliceosome
Cellular Component
GO:0000974 Prp19 complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005739 mitochondrion
GO:0016607 nuclear speck
GO:0071007 U2-type catalytic step 2 spliceosome
GO:0071013 catalytic step 2 spliceosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qtt, PDBe:7qtt, PDBj:7qtt
PDBsum7qtt
PubMed37165190
UniProtQ9P013|CWC15_HUMAN Spliceosome-associated protein CWC15 homolog (Gene Name=CWC15)

[Back to BioLiP]