BioLiP

Structure of PDB 1yi2 Chain P

Receptor sequence

>1yi2P (length=143) Species: 2238 (Haloarcula marismortui) [Search protein sequence]

TDLSAQKRLAADVLDVGKNRVWFNPERQGDIADAITREDVRELVDEGAIQ
AKDKKGNSRGRARERQKKRAYGHQKGAGSRKGKAGARQNSKEDWESRIRA
QRTKLRELRDEGTLSSSQYRDLYDKAGGGEFDSVADLERYIDA

3D structure

PDB

1yi2 Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.

Chain

Resolution

2.65 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	P	T1 D2 L3 K7 R8 G17 K18 N19 R20 W22 F23 P25 Q28 T36 R37 R41 K52 K54 K55 G56 N57 S58 R59 G60 R61 R63 R65 Q66 K68 R69 A70 Y71 H73 Q74 K75 G76 G78 R80 K81 G82 K83 A84 G85 A86 R87 Q88 K91 W94 E95 S96 R97 R99 A100 R102 R109 S116 S117 Y119 R120 Y123 D124 G128 E130 S133 V134	T1 D2 L3 K7 R8 G17 K18 N19 R20 W22 F23 P25 Q28 T36 R37 R41 K52 K54 K55 G56 N57 S58 R59 G60 R61 R63 R65 Q66 K68 R69 A70 Y71 H73 Q74 K75 G76 G78 R80 K81 G82 K83 A84 G85 A86 R87 Q88 K91 W94 E95 S96 R97 R99 A100 R102 R109 S116 S117 Y119 R120 Y123 D124 G128 E130 S133 V134

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

PDB	RCSB:1yi2, PDBe:1yi2, PDBj:1yi2
PDBsum	1yi2
PubMed	15851032
UniProt	P14119\|RL19E_HALMA Large ribosomal subunit protein eL19 (Gene Name=rpl19e)