Structure of PDB 1iw7 Chain P

Receptor sequence

>1iw7P (length=345) Species: 274 (Thermus thermophilus)

KISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLD
PDLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRY
LHIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRA
VEKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSR
TARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGD
EKDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRK
GLIDGEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD

3D structure

• PDB: 1iw7 Crystal structure of a bacterial RNA polymerase holoenzyme at 2.6 A resolution
• Chain: P
• Resolution: 2.6 Å

Enzymatic activity

• Enzyme Commision number: 2.7.7.6: DNA-directed RNA polymerase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MG	P	P80 Y84	P7 Y11
BS02	MG	P	L375 I376	L302 I303
BS03	MG	P	D343 Q347	D270 Q274
BS04	MG	P	R273 T274	R200 T201
BS05	MG	P	R142 P145 G146	R69 P72 G73
BS06	MG	P	S165 L166 P167	S92 L93 P94
BS07	MG	P	Q161 K164	Q88 K91
BS08	MG	P	M367 V368 L371 R372	M294 V295 L298 R299
BS09	MG	P	E101 R104 K105	E28 R31 K32

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0016987 sigma factor activity

Biological Process

• GO:0006352 DNA-templated transcription initiation
• GO:0006355 regulation of DNA-templated transcription
• GO:0010468 regulation of gene expression
• GO:2000142 regulation of DNA-templated transcription initiation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:1iw7, PDBe:1iw7, PDBj:1iw7
• PDBsum: 1iw7
• PubMed: 12000971
• UniProt: Q72L95|SIGA_THET2 RNA polymerase sigma factor SigA (Gene Name=sigA)