Structure of PDB 8wi7 Chain O

Receptor sequence

>8wi7O (length=145) Species: 246196 (Mycolicibacterium smegmatis MC2 155)

VIKLHDLKPAPGEKKAKTRVGRGEGSKGKTAGRGTKGTKARKNVPVMFEG
GQMPIHMRLPKLKGFKNRFRTEYQVVNVGDINKAFPQGGTVGVDELVAKG
LVRKNSLVKVLGDGKLTVKVDVTANKFSGSAREAITAAGGSATEL

3D structure

• PDB: 8wi7 Cryo- EM structure of the mycobacterial 70S ribosome in complex with ribosome hibernation promotion factor RafH.
• Chain: O
• Resolution: 3.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	O	L6 H7 E15 K16 K17 T20 R21 G23 R24 G25 G27 K29 K31 T32 A33 G34 R35 G36 T37 K38 G39 T40 R43 K44 F50 E51 G52 G53 Q54 M59 R60 P62 K63 K65 G66 F67 K68 F71 R72 Q76 N79 R105 K106 K111 L113 D115 S130	L4 H5 E13 K14 K15 T18 R19 G21 R22 G23 G25 K27 K29 T30 A31 G32 R33 G34 T35 K36 G37 T38 R41 K42 F48 E49 G50 G51 Q52 M57 R58 P60 K61 K63 G64 F65 K66 F69 R70 Q74 N77 R103 K104 K109 L111 D113 S128

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8wi7, PDBe:8wi7, PDBj:8wi7
• PDBsum: 8wi7
• PubMed: 38245551
• UniProt: A0QSG8