Structure of PDB 7d0j Chain O

Receptor sequence
>7d0jO (length=93) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
ASNKSFPRDWVKTDPLVPVLGFAGWTIPANIGVSAFGGQSLFGLFTQSIG
ENLAHFPTGPALDDKFWLYLITYHLGLFLTITLGQIGVQGRKQ
3D structure
PDB7d0j Structure of photosystem I-LHCI-LHCII from the green alga Chlamydomonas reinhardtii in State 2.
ChainO
Resolution3.42 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA O T112 I116 K122 T82 I86 K92
BS02 CLA O G89 W97 G59 W67
BS03 CLA O I79 L100 H104 L107 F108 I49 L70 H74 L77 F78
BS04 CLA O L113 G114 G117 Q123 L83 G84 G87 Q93
BS05 CLA O F72 T76 F42 T46
External links