Structure of PDB 5fci Chain N6
Receptor sequence
| >5fciN6 (length=126) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] |
| AKQSLDVSSDRRKARKAYFTAPSSQRRVLLSAPLSKELRAQYGIKALPIR RDDEVLVVRGSKKGQEGKISSVYRLKFAVQVDKVTKEKVNGASVPINLHP SKLVITKLHLDKDRKALIQRKGGKLE |
3D structure
| PDB | 5fci ? | ||
| Chain | N6 | ||
| Resolution | 3.4 Å | ||
| 3D structure |
|
Enzymatic activity
| Enzyme Commision number | ? |
Interaction with ligand
| Site # |
Ligand | Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
|---|---|---|---|---|---|
| BS01 | rna | N6 | A2 K3 Q4 S5 S9 S10 R12 K14 A15 R16 Y19 V29 L30 R40 K46 R60 G61 S62 K89 V90 H100 S102 K103 R121 K122 | A1 K2 Q3 S4 S8 S9 R11 K13 A14 R15 Y18 V28 L29 R39 K45 R59 G60 S61 K88 V89 H99 S101 K102 R120 K121 | |
| BS02 | rna | N6 | R12 R13 R16 K17 F20 P23 S24 S25 R28 R51 R52 Y74 R75 D112 K113 D114 K116 | R11 R12 R15 K16 F19 P22 S23 S24 R27 R50 R51 Y73 R74 D111 K112 D113 K115 | |
| BS03 | MG | N6 | R75 L76 | R74 L75 |
Gene Ontology
| Molecular Function | |
|---|---|
| GO:0003723 | RNA binding |
| GO:0003735 | structural constituent of ribosome |
