Structure of PDB 6tcl Chain L2

Receptor sequence
>6tclL2 (length=167) Species: 103690 (Nostoc sp. PCC 7120 = FACHB-418) [Search protein sequence]
AQAVDASKNLPSDPRNREVVFPAGRDPQWGNLETPVNASPLVKWFINNLP
AYRPGLTPFRRGLEVGMAHGYFLFGPFAKLGPLRDAANANLAGLLGAIGL
VVLFTLALSLYANSNPPTALASVTVPNPPDAFQSKEGWNNFASAFLIGGI
GGAVVAYFLTSNLALIQ
3D structure
PDB6tcl Distinct structural modulation of photosystem I and lipid environment stabilizes its tetrameric assembly.
ChainL2
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA L2 T35 V37 T34 V36
BS02 CLA L2 P77 F78 L81 P76 F77 L80
BS03 CLA L2 P83 L84 P82 L83
BS04 AJP L2 P41 W45 P40 W44
BS05 AJP L2 V20 F22 V19 F21
BS06 CLA L2 R54 R61 E65 M68 R53 R60 E64 M67
BS07 CLA L2 F46 P51 A52 H70 F73 F45 P50 A51 H69 F72
BS08 CLA L2 Y72 F73 K80 T161 Y71 F72 K79 T160
BS09 CLA L2 S110 L147 S109 L146
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009538 photosystem I reaction center
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tcl, PDBe:6tcl, PDBj:6tcl
PDBsum6tcl
PubMed32170279
UniProtP58577|PSAL_NOSS1 Photosystem I reaction center subunit XI (Gene Name=psaL)

[Back to BioLiP]