Structure of PDB 1b8d Chain L

Receptor sequence

>1b8dL (length=177) Species: 42003 (Griffithsia monilis) [Search protein sequence]

MLDAFSRVVVTSDAKAAYVGGSDLQSLKSFINDGNKRLDAVNYIVSNASC
IVSDAVSGMICENPGLIAPGGNCYTNRRMAACLRDGEIILRYVSYALLAG
DSSVLDDRCLNGLKETYIALGVPTASSSRAVSIMKATATAFITNTASGRK
VEVAAGDCQALQAEAASYFDKVGSSID

3D structure

PDB

1b8d Crystal structure of a phycourobilin-containing phycoerythrin at 1.90-A resolution.

Chain

Resolution

1.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	PEB	L	M59 N72 C73 R77 R78 A81 C82 R84 D85 I88 L120 V122 P123 S126 S127	M59 N72 C73 R77 R78 A81 C82 R84 D85 I88 L120 V122 P123 S126 S127
BS02	PEB	L	N35 K36 L38 D39 I142 V153 A154 G156 C158	N35 K36 L38 D39 I142 V153 A154 G156 C158
BS03	PUB	L	C50 D54 S57 G58 C61 R129 I133 A136 T137 A146 S147 G148	C50 D54 S57 G58 C61 R129 I133 A136 T137 A146 S147 G148

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1b8d, PDBe:1b8d, PDBj:1b8d
PDBsum	1b8d
PubMed	10388620
UniProt	O36004\|PHEB_GRIMO R-phycoerythrin beta chain (Gene Name=cpeB)

[Back to BioLiP]

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417