BioLiP

Structure of PDB 8c91 Chain J

Receptor sequence

>8c91J (length=140) Species: 562 (Escherichia coli) [Search protein sequence]

MKTFTAKPETVKRDWYVVDATGKTLGRLATELARRLRGKHKAEYTPHVDT
GDYIIVLNADKVAVTGNKRTDKVYYHHTGHIIKQATFEEMIARRPERVIE
IAVKGMLPKGPLGRAMFRKLKVYAGNEHNHAAQQPQVLDI

3D structure

PDB

8c91 Cryo-EM captures early ribosome assembly in action.

Chain

Resolution

4.19 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	J	K2 T3 K7 W15 L25 G26 R27 T30 H47 Y53 T65 N67 K68 K72 Y74 Y75 H77 H80 K85 R96 R99 E102 M108 K111 P113 L114 R120 N131 H132 A134 Q135	K2 T3 K7 W15 L25 G26 R27 T30 H47 Y53 T65 N67 K68 K72 Y74 Y75 H77 H80 K83 R94 R97 E100 M106 K109 P111 L112 R118 N129 H130 A132 Q133

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding
GO:0048027	mRNA 5'-UTR binding
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0017148	negative regulation of translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

PDB	RCSB:8c91, PDBe:8c91, PDBj:8c91
PDBsum	8c91
PubMed	36797249
UniProt	P0AA10\|RL13_ECOLI Large ribosomal subunit protein uL13 (Gene Name=rplM)