Structure of PDB 7wfg Chain I

Receptor sequence
>7wfgI (length=160) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
TGFMNYGQQTLRAARYIGQGFMITLSHTNRLPVTIQYPYTSERFRGRIHF
EFDKCIACEVCVRVCPIDLPVVDWKLETNIRKKRLLNYSIDFGICIFCGN
CVEYCPTNCLSMTEEYEFSTYDRHELNYNQIALGRLPMSVIDDYTIRTIW
NSPQTKNGVN
3D structure
PDB7wfg Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
ChainI
Resolution4.33 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 7.1.1.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SF4 I C74 C104 F106 C107 G108 N109 C110 C65 C95 F97 C98 G99 N100 C101
BS02 SF4 I C64 I65 A66 C67 E68 V69 C70 C114 T116 C55 I56 A57 C58 E59 V60 C61 C105 T107
Gene Ontology
Molecular Function
GO:0003959 NADPH dehydrogenase activity
GO:0005506 iron ion binding
GO:0008137 NADH dehydrogenase (ubiquinone) activity
GO:0016651 oxidoreductase activity, acting on NAD(P)H
GO:0016655 oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
GO:0046872 metal ion binding
GO:0048038 quinone binding
GO:0051539 4 iron, 4 sulfur cluster binding
Biological Process
GO:0015979 photosynthesis
GO:0019684 photosynthesis, light reaction
GO:1902600 proton transmembrane transport
Cellular Component
GO:0009507 chloroplast
GO:0009535 chloroplast thylakoid membrane
GO:0009536 plastid
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wfg, PDBe:7wfg, PDBj:7wfg
PDBsum7wfg
PubMed35123031
UniProtP56755|NDHI_ARATH NAD(P)H-quinone oxidoreductase subunit I, chloroplastic (Gene Name=ndhI)

[Back to BioLiP]