Structure of PDB 1w2b Chain I

Receptor sequence
>1w2bI (length=142) Species: 2238 (Haloarcula marismortui) [Search protein sequence]
AEFDADVIVDARDCIMGRVASQVAEQALDGETVAVVNAERAVITGREEQI
VEKYEKRVDIGNDNGYFYPKRPDGIFKRTIRGMLPHKKQRGREAFESVRV
YLGNPYDEDGEVLDGTSLDRLSNIKFVTLGEISETLGANKTW
3D structure
PDB1w2b Trigger Factor in Complex with the Ribosome Forms a Molecular Cradle for Nascent Proteins
ChainI
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna I I18 G20 R21 S24 L31 T47 G48 R49 R60 I63 N65 N67 G68 Y69 F70 P72 K73 R74 K80 T82 R84 M86 P88 H89 K90 K91 R95 R102 V103 K128 G140 I15 G17 R18 S21 L28 T44 G45 R46 R57 I60 N62 N64 G65 Y66 F67 P69 K70 R71 K77 T79 R81 M83 P85 H86 K87 K88 R92 R99 V100 K125 G137 PDBbind-CN: Kd=1.2uM
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
GO:0017148 negative regulation of translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1w2b, PDBe:1w2b, PDBj:1w2b
PDBsum1w2b
PubMed15334087
UniProtP29198|RL13_HALMA Large ribosomal subunit protein uL13 (Gene Name=rpl13)

[Back to BioLiP]