BioLiP

Structure of PDB 1yi2 Chain H

Receptor sequence

>1yi2H (length=160) Species: 2238 (Haloarcula marismortui) [Search protein sequence]

KPASMYRDIDKPAYTRREYITGIPGSKIAQHKMGRKQKDADDYPVQISLI
VEETVQLRHGSLEASRLSANRHLIKELGEEGDYKMTLRKFPHQVLRENKD
GMRAAFGKIVGTAARVQAGEQLFTAYCNVEDAEHVKEAFRRAYNKITPSC
RIKVERGEEL

3D structure

PDB

1yi2 Structures of MLSBK antibiotics bound to mutated large ribosomal subunits provide a structural explanation for resistance.

Chain

Resolution

2.65 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	H	K4 A6 M8 R10 K14 P15 A16 Y17 T18 R19 E21 Y22 K35 K39 R61 S64 A67 R74 R91 K92 F93 H95 R99 E100 N101 M116 R117 A118 A119 F120 G121 R154 Y157 N158 K159 T161 S163	K1 A3 M5 R7 K11 P12 A13 Y14 T15 R16 E18 Y19 K32 K36 R58 S61 A64 R71 R88 K89 F90 H92 R96 E97 N98 M102 R103 A104 A105 F106 G107 R140 Y143 N144 K145 T147 S149

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

PDB	RCSB:1yi2, PDBe:1yi2, PDBj:1yi2
PDBsum	1yi2
PubMed	15851032
UniProt	P60617\|RL10E_HALMA Large ribosomal subunit protein uL16 (Gene Name=rpl10e)