Structure of PDB 1aht Chain H

Receptor sequence

>1ahtH (length=251) Species: 9606 (Homo sapiens)

IVEGSDAEIGMSPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPW
DKNFTENDLLVRIGKHSRTRYERNIEKISMLEKIYIHPRYNWRENLDRDI
ALMKLKKPVAFSDYIHPVCLPDRETAASLLQAGYKGRVTGWGNLKETGQP
SVLQVVNLPIVERPVCKDSTRIRITDNMFCAGYKPDEGKRGDACEGDSGG
PFVMKSPFNNRWYQMGIVSWGEGCDRDGKYGFYTHVFRLKKWIQKVIDQF
G

3D structure

• PDB: 1aht Crystal structure of human alpha-thrombin complexed with hirugen and p-amidinophenylpyruvate at 1.6 A resolution.
• Chain: H
• Resolution: 1.6 Å

Enzymatic activity

• Enzyme Commision number: 3.4.21.5: thrombin.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	H	E23 G25 M26 P28 W29 D116 H119 P120 C122 Y134 K135 R137 N159 M201 K202 R206 W207	E8 G10 M11 P13 W14 D113 H116 P117 C119 Y134 K135 R137 N157 M204 K205 R211 W212
BS02	peptide	H	L65 R67 R73 T74 R75 Y76 K81 I82 M84	L60 R62 R68 T69 R70 Y71 K77 I78 M80
BS03	APA	H	H57 D189 A190 C191 E192 G193 S195 V213 W215	H43 D192 A193 C194 E195 G196 S198 V218 W220	PDBbind-CN: -logKd/Ki=6.21,Ki=0.62uM

Gene Ontology

Molecular Function

• GO:0004252 serine-type endopeptidase activity
• GO:0005509 calcium ion binding

Biological Process

• GO:0006508 proteolysis
• GO:0007596 blood coagulation

External links

• PDB: RCSB:1aht, PDBe:1aht, PDBj:1aht
• PDBsum: 1aht
• PubMed: 7574675
• UniProt: P00734|THRB_HUMAN Prothrombin (Gene Name=F2)