Structure of PDB 7d0j Chain G

Receptor sequence
>7d0jG (length=91) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
LDPQIVISGSTAAFLAIGRFVFLGYQRREANFDSTVGPKTTGATYFDDLQ
KNSTIFATNDPAGFNIIDVAGWGALGHAVGFAVLAINSLQG
3D structure
PDB7d0j Structure of photosystem I-LHCI-LHCII from the green alga Chlamydomonas reinhardtii in State 2.
ChainG
Resolution3.42 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA G L80 F87 L49 F56
BS02 CLA G Y56 E60 Y25 E29
BS03 CLA G Q35 S39 A43 H108 F112 Q4 S8 A12 H77 F81
BS04 CLA G R50 N90 D91 P92 F95 R19 N59 D60 P61 F64
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0016020 membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7d0j, PDBe:7d0j, PDBj:7d0j
PDBsum7d0j
PubMed33597543
UniProtP14224|PSAG_CHLRE Photosystem I reaction center subunit V, chloroplastic (Gene Name=PSAG)

[Back to BioLiP]