Structure of PDB 6ha1 Chain F

Receptor sequence

>6ha1F (length=176) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

NRLKEKYNKEIAPALMTKFNYDSVMQVPKIEKIVINMGVGDAVQNAKAID
SAVEELTFIAGQKPVVTRAKKSIAGFRLREGMPIGAKVTLRGERMYDFLD
KLISVSLPRVRDFRGVSKKSFDGRGNYTLGIKEQLIFPEIDYDKVTKVRG
MDIVIVTTANTDEEARELLTQVGMPF

3D structure

• PDB: 6ha1 Structural basis for antibiotic resistance mediated by theBacillus subtilisABCF ATPase VmlR.
• Chain: F
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	K33 N37 G39 G41 T68 A70 K71 K72 F77 I85 K88 K120 S121 F122 D123 R125 T129 G131 I132 R150 G151 M152 D153 V155	K32 N36 G38 G40 T67 A69 K70 K71 F76 I84 K87 K119 S120 F121 D122 R124 T128 G130 I131 R149 G150 M151 D152 V154
BS02	rna	F	V25 M26 Q27 Q63 K64 V66 T90 R92	V24 M25 Q26 Q62 K63 V65 T89 R91
BS03	rna	F	S73 A75 R78 R80	S72 A74 R77 R79

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ha1, PDBe:6ha1, PDBj:6ha1
• PDBsum: 6ha1
• PubMed: 30126986
• UniProt: P12877|RL5_BACSU Large ribosomal subunit protein uL5 (Gene Name=rplE)