Structure of PDB 1n8r Chain F

Receptor sequence

>1n8rF (length=140) Species: 2238 (Haloarcula marismortui)

FHEMREPRIEKVVVHMGIGHANAEDILGEITGQMPVRTKAKRTVGEFDIR
EGDPIGAKVTLRDEMAEEFLQTALPLAELATSQFDDTGNFSFGLDVTVNL
VRPGYRVAKRDKASRSIPTKHRLNPADAVAFIESTYDVEV

3D structure

• PDB: 1n8r Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
• Chain: F
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	K20 V22 H24 T52 A54 K55 R56 E60 K72 S96 Q97 D99 D100 T101 N103 S105 G107 D129 N133 R156	K11 V13 H15 T38 A40 K41 R42 E46 K58 S82 Q83 D85 D86 T87 N89 S91 G93 D95 N99 R122
BS02	rna	F	E12 M13 R14 R17 M48 V50 R51 K72 V73 T74 R76 P137 G138 R140 V141 R144 D145 R149 P152 K154 H155	E3 M4 R5 R8 M34 V36 R37 K58 V59 T60 R62 P103 G104 R106 V107 R110 D111 R115 P118 K120 H121

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:1n8r, PDBe:1n8r, PDBj:1n8r
• PDBsum: 1n8r
• PubMed: 12860128
• UniProt: P14124|RL5_HALMA Large ribosomal subunit protein uL5 (Gene Name=rpl5)