Structure of PDB 1yit Chain E

Receptor sequence

>1yitE (length=172) Species: 2238 (Haloarcula marismortui) [Search protein sequence]

PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIE
SDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGD
EVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQ
LTRINDKDVRVFQDGVYITRKP

3D structure

PDB

1yit Structures of Mlsbk Antibiotics Bound to Mutated Large Ribosomal Subunits Provide a Structural Explanation for Resistance.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	E	Y35 N55 A56 K57 S60 G63 T64 S67 H68 N71 Y82 H90 F91 E110 K111 A112 H119 E139 G142 Q143 A146 Q150 R153 N155 K157 D158 R160 V161 F162	Y35 N55 A56 K57 S60 G63 T64 S67 H68 N71 Y82 H90 F91 E110 K111 A112 H119 E139 G142 Q143 A146 Q150 R153 N155 K157 D158 R160 V161 F162

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1yit, PDBe:1yit, PDBj:1yit
PDBsum	1yit
PubMed	15851032
UniProt	P14135\|RL6_HALMA Large ribosomal subunit protein uL6 (Gene Name=rpl6)

[Back to BioLiP]

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417