Structure of PDB 1kqs Chain E

Receptor sequence
>1kqsE (length=172) Species: 2238 (Haloarcula marismortui) [Search protein sequence]
PRVELEIPEDVDAEQDHLDITVEGDNGSVTRRLWYPDIDVSVDGDTVVIE
SDEDNAKTMSTIGTFQSHIENMFHGVTEGWEYGMEVFYSHFPMQVNVEGD
EVVIENFLGEKAPRRTTIHGDTDVEIDGEELTVSGPDIEAVGQTAADIEQ
LTRINDKDVRVFQDGVYITRKP
3D structure
PDB1kqs A pre-translocational intermediate in protein synthesis observed in crystals of enzymatically active 50S subunits.
ChainE
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna E Y35 N55 A56 S60 G63 T64 S67 H68 N71 Y82 H90 F91 E110 K111 A112 E139 G142 Q143 A146 Q150 R153 N155 K157 D158 R160 V161 F162 Y35 N55 A56 S60 G63 T64 S67 H68 N71 Y82 H90 F91 E110 K111 A112 E139 G142 Q143 A146 Q150 R153 N155 K157 D158 R160 V161 F162
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1kqs, PDBe:1kqs, PDBj:1kqs
PDBsum1kqs
PubMed11828326
UniProtP14135|RL6_HALMA Large ribosomal subunit protein uL6 (Gene Name=rpl6)

[Back to BioLiP]