Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 4v87 Chain CK

Receptor sequence

>4v87CK (length=138) Species: 300852 (Thermus thermophilus HB8)

MLTDPIADMLTRIRNATRVYKESTDVPASRFKEEILRILAREGFIKGYER
VDVDGKPYLRVYLKYGPRRQGPDPRPEQVIHHIRRISKPGRRVYVGVKEI
PRVRRGLGIAILSTSKGVLTDREARKLGVGGELICEVW

3D structure

• PDB: 4v87 A new understanding of the decoding principle on the ribosome.
• Chain: CK
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	CK	M1 T3 T11 R12 R14 N15 A28 S29 R30 F31 R75 K88 P89 G90 R91 R92 Y94 V95 G96 V97 K98 S113 T114 S115 G128 G130 E132	M1 T3 T11 R12 R14 N15 A28 S29 R30 F31 R75 K88 P89 G90 R91 R92 Y94 V95 G96 V97 K98 S113 T114 S115 G128 G130 E132

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sat May 17 07:31:02 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1709                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1710         else:

=> 1711             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1712     

   1713     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v87', asym_id = 'CK', title = 'A new understanding of the decoding principle on the ribosome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v87', asym_id='CK', title='A new understanding of the decoding principle on the ribosome.')

    843 

    844     if go:

=>  845         display_go(go,uniprot,pdbid,asym_id)

    846     return pubmed,uniprot

    847 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v87', asym_id = 'CK'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v87', asym_id='CK')

    484         '''.replace("$namespace_link",namespace_link

    485           ).replace("$namespace",namespace

=>  486           ).replace("$uniprot",u

    487         ))

    488         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>