Structure of PDB 5i4l Chain C5
Receptor sequence
| >5i4lC5 (length=124) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] |
| KKRVFKTHSYRGVDLEKLLEMSTEDFVKLAPARVRRRFARGMTSKPAGFM KKLRAAKLAAPENEKPAPVRTHMRNMIIVPEMIGSVVGIYNGKAFNQVEI RPEMLGHYLGEFSITYTPVRHGRA |
3D structure
| PDB | 5i4l Amicoumacin A induces cancer cell death by targeting the eukaryotic ribosome. | ||
| Chain | C5 | ||
| Resolution | 3.1 Å | ||
| 3D structure |
|
Enzymatic activity
| Enzyme Commision number | ? |
Interaction with ligand
| Site # |
Ligand | Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
|---|---|---|---|---|---|
| BS01 | rna | C5 | R18 P38 A39 R40 R42 R43 R44 R47 K59 R77 H79 R81 N82 Y97 N98 G99 K100 Y115 G117 E118 T122 T124 V126 R127 H128 | R11 P31 A32 R33 R35 R36 R37 R40 K52 R70 H72 R74 N75 Y90 N91 G92 K93 Y108 G110 E111 T115 T117 V119 R120 H121 | |
| BS02 | rna | C5 | P75 R77 Q104 | P68 R70 Q97 | |
| BS03 | OHX | C5 | L65 A67 E69 | L58 A60 E62 |
Gene Ontology
| Molecular Function | |
|---|---|
| GO:0003723 | RNA binding |
| GO:0003735 | structural constituent of ribosome |
