BioLiP

Structure of PDB 8c91 Chain C

Receptor sequence

>8c91C (length=156) Species: 562 (Escherichia coli) [Search protein sequence]

VNPELHKGKPFAPLLEAYRIVDFKRNKDGIPAVVERLEYDPNRSANIALV
LYKDGERRYILAPKGLKAGDQIQSGVDAAIKPGNTLPMRNIPVGSTVHNV
EMKPGKGGQLARSAGTYVQIVARDGAYVTLRLRSGEMRKVEADCRATLGE
VGNAEH

3D structure

PDB

8c91 Cryo-EM captures early ribosome assembly in action.

Chain

Resolution

4.19 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	V19 K25 A60 Y61 R62 I73 Y82 P84 R86 L94 K96 D97 G98 R100 K146 Q152 L153 R155 S156 A157 G158 S177 E179 R181 A197 H199	V1 K7 A17 Y18 R19 I30 Y39 P41 R43 L51 K53 D54 G55 R57 K103 Q109 L110 R112 S113 A114 G115 S134 E136 R138 A154 H156

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0032297	negative regulation of DNA-templated DNA replication initiation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990082	DnaA-L2 complex
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

PDB	RCSB:8c91, PDBe:8c91, PDBj:8c91
PDBsum	8c91
PubMed	36797249
UniProt	P60422\|RL2_ECOLI Large ribosomal subunit protein uL2 (Gene Name=rplB)