Structure of PDB 7z2z Chain C

Receptor sequence
>7z2zC (length=335) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
MSNIVGIEYNRVTNTTSTDFPGFSKDAENEWNVEKFKKDFEVNISSLDAR
EANFDLINIDTSIANAFRRIMISEVPSVAAEYVYFFNNTSVIQDEVLAHR
IGLVPLKVDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGS
TDPKELYNNAHVYARDLKFEPQGRQSTTFADCPVVPADPDILLAKLRPGQ
EISLKAHCILGIGGDHAKFSPVSTASYRLLPQINILQPIKGESARRFQKC
FPPGVIGIDEGSDEAYVKDARKDTVSREVLRYEEFADKVKLGRVRNHFIF
NVESAGAMTPEEIFFKSVRILKNKAEYLKNCPITQ
3D structure
PDB7z2z Structural basis of Ty1 integrase tethering to RNA polymerase III for targeted retrotransposon integration.
ChainC
Resolution3.07 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide C L47 P76 D111 W115 E311 F315 I320 L47 P76 D111 W115 E311 F315 I320
Gene Ontology
Molecular Function
GO:0001054 RNA polymerase I activity
GO:0001056 RNA polymerase III activity
GO:0003677 DNA binding
GO:0003899 DNA-directed 5'-3' RNA polymerase activity
GO:0005515 protein binding
GO:0046983 protein dimerization activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006360 transcription by RNA polymerase I
GO:0006361 transcription initiation at RNA polymerase I promoter
GO:0006362 transcription elongation by RNA polymerase I
GO:0006363 termination of RNA polymerase I transcription
GO:0006383 transcription by RNA polymerase III
GO:0006384 transcription initiation at RNA polymerase III promoter
GO:0006386 termination of RNA polymerase III transcription
GO:0042254 ribosome biogenesis
GO:0042790 nucleolar large rRNA transcription by RNA polymerase I
GO:0042797 tRNA transcription by RNA polymerase III
Cellular Component
GO:0000428 DNA-directed RNA polymerase complex
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005666 RNA polymerase III complex
GO:0005730 nucleolus
GO:0005736 RNA polymerase I complex
GO:0055029 nuclear DNA-directed RNA polymerase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7z2z, PDBe:7z2z, PDBj:7z2z
PDBsum7z2z
PubMed36977686
UniProtP07703|RPAC1_YEAST DNA-directed RNA polymerases I and III subunit RPAC1 (Gene Name=RPC40)

[Back to BioLiP]