Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only
Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

BioLiP

Structure of PDB 7r0j Chain C

Receptor sequence
>7r0jC (length=354) Species: 9606 (Homo sapiens) [Search protein sequence]
TRVFKKASPNGKLTVYLGKRDFVDHIDLVDPVDGVVLVDPEYLKERRVYV
TLTCAFRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLI
KKLGEHAYPFTFEIPPNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLE
EKIHKRNSVRLVIRKVQYAPERPGPQPTAETTRQFLMSDKPLHLEASLDK
EIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYADICLFNTAQYKCPVAM
EEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNLASSTL
LREGANREILGIIVSYKVKVKLVVSRASSDVAVELPFTLMHPKPKEEPPH
REVP
3D structure
PDB7r0j Structure of the vasopressin hormone-V2 receptor-beta-arrestin1 ternary complex.
ChainC
Resolution4.23 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide C T6 R7 V8 F9 K10 K11 A12 S13 P14 R25 R103 K107 K294 T1 R2 V3 F4 K5 K6 A7 S8 P9 R20 R98 K102 K289
Gene Ontology
Molecular Function
GO:0001664 G protein-coupled receptor binding
GO:0003713 transcription coactivator activity
GO:0004402 histone acetyltransferase activity
GO:0004857 enzyme inhibitor activity
GO:0005096 GTPase activator activity
GO:0005159 insulin-like growth factor receptor binding
GO:0005515 protein binding
GO:0031625 ubiquitin protein ligase binding
GO:0031701 angiotensin receptor binding
GO:1990763 arrestin family protein binding
Biological Process
GO:0001934 positive regulation of protein phosphorylation
GO:0002031 G protein-coupled receptor internalization
GO:0002092 positive regulation of receptor internalization
GO:0006357 regulation of transcription by RNA polymerase II
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0007165 signal transduction
GO:0007601 visual perception
GO:0009968 negative regulation of signal transduction
GO:0015031 protein transport
GO:0016567 protein ubiquitination
GO:0031397 negative regulation of protein ubiquitination
GO:0032088 negative regulation of NF-kappaB transcription factor activity
GO:0032715 negative regulation of interleukin-6 production
GO:0032717 negative regulation of interleukin-8 production
GO:0035025 positive regulation of Rho protein signal transduction
GO:0043149 stress fiber assembly
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0045746 negative regulation of Notch signaling pathway
GO:0045944 positive regulation of transcription by RNA polymerase II
GO:0070374 positive regulation of ERK1 and ERK2 cascade
Cellular Component
GO:0000139 Golgi membrane
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005765 lysosomal membrane
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0005905 clathrin-coated pit
GO:0016604 nuclear body
GO:0030659 cytoplasmic vesicle membrane
GO:0030666 endocytic vesicle membrane
GO:0031143 pseudopodium
GO:0031410 cytoplasmic vesicle
GO:0042995 cell projection

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7r0j, PDBe:7r0j, PDBj:7r0j
PDBsum7r0j
PubMed36054364
UniProtP49407|ARRB1_HUMAN Beta-arrestin-1 (Gene Name=ARRB1)

[Back to BioLiP]

zhanglabzhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417