Home Research COVID-19 Services Publications People Teaching Job Opening News Forum Lab Only

Online Services

●I-TASSER ●I-TASSER-MTD ●C-I-TASSER ●CR-I-TASSER ●QUARK ●C-QUARK ●LOMETS ●MUSTER ●CEthreader ●SEGMER ●DeepFold ●DeepFoldRNA ●FoldDesign ●COFACTOR ●COACH ●MetaGO ●TripletGO ●IonCom ●FG-MD ●ModRefiner ●REMO ●DEMO ●DEMO-EM ●SPRING ●COTH ●Threpp ●PEPPI ●BSpred ●ANGLOR ●EDock ●BSP-SLIM ●SAXSTER ●FUpred ●ThreaDom ●ThreaDomEx ●EvoDesign ●BindProf ●BindProfX ●SSIPe ●GPCR-I-TASSER ●MAGELLAN ●ResQ ●STRUM ●DAMpred

●TM-score ●TM-align ●US-align ●MM-align ●RNA-align ●NW-align ●LS-align ●EDTSurf ●MVP ●MVP-Fit ●SPICKER ●HAAD ●PSSpred ●3DRobot ●MR-REX ●I-TASSER-MR ●SVMSEQ ●NeBcon ●ResPRE ●TripletRes ●DeepPotential ●WDL-RF ●ATPbind ●DockRMSD ●DeepMSA ●FASPR ●EM-Refiner ●GPU-I-TASSER

●BioLiP ●E. coli ●GLASS ●GPCR-HGmod ●GPCR-RD ●GPCR-EXP ●Tara-3D ●TM-fold ●DECOYS ●POTENTIAL ●RW/RWplus ●EvoEF ●HPSF ●THE-DB ●ADDRESS ●Alpaca-Antibody ●CASP7 ●CASP8 ●CASP9 ●CASP10 ●CASP11 ●CASP12 ●CASP13 ●CASP14

Structure of PDB 5xw6 Chain C

Receptor sequence

>5xw6C (length=320) Species: 9031 (Gallus gallus)

SCVKWFIYGVIAVYICYTLIVHKRYQEKEELTSSVRVTLKGVAHVDRIWD
AAEYTIPTQTRDSFFVMTNIIRTENQIQKTCPEYPTAKAICSSDKSCAKG
IVDVHSNGVQTGKCVHYNITHKTCEIKAWCPVQGEERPPVPAVLRSSEDF
TVFIKNNIHFPTFQYTVQNISPKLNTSCKFNKVTAPLCPIFRLGDILQEA
KENFSEMAVKGGIIAIEIKWDCDLDSWSYYCSPEYSFRRLDDKTRTQYPG
FSIRFARHYKLPDGTEQRTLFKAYGIRFDVLVFGMGGQFKLIELFTFIGS
TIAYFGLAVTIIEMCFHLYN

3D structure

• PDB: 5xw6 Structural insights into the competitive inhibition of the ATP-gated P2X receptor channel
• Chain: C
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	128	C	T64 K66 T177 F179 T202 I216	T38 K40 T151 F153 T176 I190	PDBbind-CN: -logKd/Ki=4.91,Kd=12.26uM
BS02	128	C	T112 A113 V130 K236 Y274 K298 Y300	T86 A87 V104 K210 Y248 K272 Y274	PDBbind-CN: -logKd/Ki=4.91,Kd=12.26uM

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun May 18 03:38:03 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1709                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1710         else:

=> 1711             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1712     

   1713     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '5xw6', asym_id = 'C', title = 'Structural insights into the competitive inhibition of the ATP-gated P2X receptor channel'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='5xw6', asym_id='C', title='Structural insights into the competitive inhibition of the ATP-gated P2X receptor channel')

    843 

    844     if go:

=>  845         display_go(go,uniprot,pdbid,asym_id)

    846     return pubmed,uniprot

    847 

global display_go = <function display_go>, go = '0001614,0004931,0005886,0033198,0098655', uniprot = '', pdbid = '5xw6', asym_id = 'C'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0001614,0004931,0005886,0033198,0098655', uniprot='', pdbid='5xw6', asym_id='C')

    484         '''.replace("$namespace_link",namespace_link

    485           ).replace("$namespace",namespace

=>  486           ).replace("$uniprot",u

    487         ))

    488         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>