Structure of PDB 4ehk Chain C

Receptor sequence
>4ehkC (length=233) Species: 9606 (Homo sapiens) [Search protein sequence]
DNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKY
EVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEAGIIFGTNGP
VDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETHKIPVEADF
LYACSTAPGYYSWRNSKDGSWFIQSLCAMLKQYADKLEFMHILTRVNRKV
ATEFESFSFDATFHAKKQIPCIVSMLTKELYFY
3D structure
PDB4ehk Allosteric modulation of caspase 3 through mutagenesis.
ChainC
Resolution1.668 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) T62 S63 G122 C163
Catalytic site (residue number reindexed from 1) T29 S30 G89 C130
Enzyme Commision number 3.4.22.56: caspase-3.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide C R64 H121 Q161 C163 Y204 S205 W206 R207 N208 S209 S249 R31 H88 Q128 C130 Y161 S162 W163 R164 N165 S166 S206
Gene Ontology
Molecular Function
GO:0002020 protease binding
GO:0004175 endopeptidase activity
GO:0004190 aspartic-type endopeptidase activity
GO:0004197 cysteine-type endopeptidase activity
GO:0004861 cyclin-dependent protein serine/threonine kinase inhibitor activity
GO:0005123 death receptor binding
GO:0005515 protein binding
GO:0008047 enzyme activator activity
GO:0008233 peptidase activity
GO:0008234 cysteine-type peptidase activity
GO:0016005 phospholipase A2 activator activity
GO:0044877 protein-containing complex binding
GO:0097153 cysteine-type endopeptidase activity involved in apoptotic process
GO:0097199 cysteine-type endopeptidase activity involved in apoptotic signaling pathway
GO:0097200 cysteine-type endopeptidase activity involved in execution phase of apoptosis
Biological Process
GO:0001554 luteolysis
GO:0001666 response to hypoxia
GO:0001782 B cell homeostasis
GO:0001818 negative regulation of cytokine production
GO:0006508 proteolysis
GO:0006915 apoptotic process
GO:0006974 DNA damage response
GO:0007413 axonal fasciculation
GO:0007507 heart development
GO:0007605 sensory perception of sound
GO:0007611 learning or memory
GO:0008627 intrinsic apoptotic signaling pathway in response to osmotic stress
GO:0009410 response to xenobiotic stimulus
GO:0009411 response to UV
GO:0009611 response to wounding
GO:0009749 response to glucose
GO:0010038 response to metal ion
GO:0010165 response to X-ray
GO:0014070 response to organic cyclic compound
GO:0016241 regulation of macroautophagy
GO:0016485 protein processing
GO:0021766 hippocampus development
GO:0030163 protein catabolic process
GO:0030182 neuron differentiation
GO:0030216 keratinocyte differentiation
GO:0030218 erythrocyte differentiation
GO:0030220 platelet formation
GO:0030889 negative regulation of B cell proliferation
GO:0031647 regulation of protein stability
GO:0032025 response to cobalt ion
GO:0032355 response to estradiol
GO:0032496 response to lipopolysaccharide
GO:0034349 glial cell apoptotic process
GO:0034612 response to tumor necrosis factor
GO:0035094 response to nicotine
GO:0035556 intracellular signal transduction
GO:0042542 response to hydrogen peroxide
GO:0043029 T cell homeostasis
GO:0043065 positive regulation of apoptotic process
GO:0043200 response to amino acid
GO:0043525 positive regulation of neuron apoptotic process
GO:0044346 fibroblast apoptotic process
GO:0045165 cell fate commitment
GO:0045786 negative regulation of cell cycle
GO:0046007 negative regulation of activated T cell proliferation
GO:0048011 neurotrophin TRK receptor signaling pathway
GO:0051146 striated muscle cell differentiation
GO:0051384 response to glucocorticoid
GO:0051402 neuron apoptotic process
GO:0051604 protein maturation
GO:0061713 anterior neural tube closure
GO:0070269 pyroptotic inflammatory response
GO:0071407 cellular response to organic cyclic compound
GO:0071887 leukocyte apoptotic process
GO:0072734 cellular response to staurosporine
GO:0097190 apoptotic signaling pathway
GO:0097193 intrinsic apoptotic signaling pathway
GO:0097194 execution phase of apoptosis
GO:0098693 regulation of synaptic vesicle cycle
GO:0140639 positive regulation of pyroptotic inflammatory response
GO:1902004 positive regulation of amyloid-beta formation
GO:1904019 epithelial cell apoptotic process
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0014069 postsynaptic density
GO:0031264 death-inducing signaling complex
GO:0043025 neuronal cell body
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ehk, PDBe:4ehk, PDBj:4ehk
PDBsum4ehk
PubMed22607239
UniProtP42574|CASP3_HUMAN Caspase-3 (Gene Name=CASP3)

[Back to BioLiP]