BioLiP

Structure of PDB 1dxr Chain C

Receptor sequence

>1dxrC (length=332) Species: 1079 (Blastochloris viridis) [Search protein sequence]

CFEPPPATTTQTGFRGLSMGEVLHPATVKAKKERDAQYPPALAAVKAEGP
PVSQVYKNVKVLGNLTEAEFLRTMTAITEWVSPQEGCTYCHDENNLASEA
KYPYVVARRMLEMTRAINTNWTQHVAQTGVTCYTCHRGTPLPPYVRYLEP
TLPLNNRETPTHVERVETRSGYVVRLAKYTAYSALNYDPFTMFLANDKRQ
VRVVPQTALPLVGVSRGKERRPLSDAYATFALMMSISDSLGTNCTFCHNA
QTFESWGKKSTPQRAIAWWGIRMVRDLNMNYLAPLNASLPASRLGRQGEA
PQADCRTCHQGVTKPLFGASRLKDYPELGPIK

3D structure

PDB

1dxr Structural basis of the drastically increased initial electron transfer rate in the reaction center from a Rhodopseudomonas viridis mutant described at 2.00-A resolution.

Chain

Resolution

2.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	HEC	C	Y56 K57 N58 K60 V61 F70 M74 T78 C87 C90 H91 L96 A97 Y104 A107 R108	Y56 K57 N58 K60 V61 F70 M74 T78 C87 C90 H91 L96 A97 Y104 A107 R108
BS02	HEC	C	Y89 Y102 P103 V106 M110 L111 M113 T114 C132 C135 H136 P140 L141 P142 L289 R293 P301	Y89 Y102 P103 V106 M110 L111 M113 T114 C132 C135 H136 P140 L141 P142 L289 R293 P301
BS03	HEC	C	V201 R202 V204 M233 S237 C244 C247 H248 F253 E254 R264 A267 W268 R272	V201 R202 V204 M233 S237 C244 C247 H248 F253 E254 R264 A267 W268 R272
BS04	HEC	C	H124 V125 T128 Q263 I266 I271 M273 C305 C308 H309 K314 P315	H124 V125 T128 Q263 I266 I271 M273 C305 C308 H309 K314 P315

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

PDB	RCSB:1dxr, PDBe:1dxr, PDBj:1dxr
PDBsum	1dxr
PubMed	11005826
UniProt	P07173\|CYCR_BLAVI Photosynthetic reaction center cytochrome c subunit (Gene Name=pufC)