Structure of PDB 8oiq Chain BN

Receptor sequence

>8oiqBN (length=250) Species: 9823 (Sus scrofa) [Search protein sequence]

PPVLRKCELPVPAHRRPVQAWIESLRGYEQERVGLTELHPDVFSTAPRLD
ILHQVAIWQKNFKRISYAKTKTRAEVRGGGRKPWVQKGSGRARHGSIRSP
IWRGGGVAHGPRGPTSYYYMLPMKVRVQGLKVALTVKLAQDDLHIVDSLE
LPTADPQYLIELARYRRWGDSVLLVDLEHEDMPQNVVAATSGLKTFNLVP
AVGLNVHSMLKHQTLVLTLPTVAFLEEKLLWHNSRYTPLYPFRLPYCDFP

3D structure

PDB

8oiq Molecular basis of translation termination at noncanonical stop codons in human mitochondria.

Chain

Resolution

3.5 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BN	R92 H97 I101 K104 N105 R108 Y111 K113 K115 R117 A118 R121 R125 K126 Q130 K131 G132 R135 A136 R137 H138 G139 R142 P144 I145 W146 R147 V151 H153 P155 Y161 Y163 P166 M167 K168 V169 R170 K255 T281 P282 P285	R48 H53 I57 K60 N61 R64 Y67 K69 K71 R73 A74 R77 R81 K82 Q86 K87 G88 R91 A92 R93 H94 G95 R98 P100 I101 W102 R103 V107 H109 P111 Y117 Y119 P122 M123 K124 V125 R126 K211 T237 P238 P241

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8oiq, PDBe:8oiq, PDBj:8oiq
PDBsum	8oiq
PubMed	37141370
UniProt	A0A287B9C4

[Back to BioLiP]