BioLiP

Structure of PDB 4v7d Chain BI

Receptor sequence

>4v7dBI (length=127) Species: 562 (Escherichia coli) [Search protein sequence]

NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLE
LVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGF
VTRDARQVERKKVGLRKARRRPQFSKR

3D structure

PDB

4v7d Structure of the ribosome with elongation factor G trapped in the pretranslocation state.

Chain

Resolution

7.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	BI	Q4 Y6 T8 R10 R11 K12 A15 R17 Y37 E41 Y63 K67 G69 G70 I71 S72 Q74 R84 R98 T104 R105 A107 R108 Q109 V110 E111 R112 K113 K114 V115 R118 K119 R121 R122 R123 P124 Q125 F126 S127 R129	Q2 Y4 T6 R8 R9 K10 A13 R15 Y35 E39 Y61 K65 G67 G68 I69 S70 Q72 R82 R96 T102 R103 A105 R106 Q107 V108 E109 R110 K111 K112 V113 R116 K117 R119 R120 R121 P122 Q123 F124 S125 R127

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

PDB	RCSB:4v7d, PDBe:4v7d, PDBj:4v7d
PDBsum	4v7d
PubMed	24324137
UniProt	P0A7X3\|RS9_ECOLI Small ribosomal subunit protein uS9 (Gene Name=rpsI)