Structure of PDB 5wri Chain B

Receptor sequence

>5wriB (length=273) Species: 9606 (Homo sapiens)

AYHKDMPLIFIGGVPRSGTTLMRAMLDAHPDIRCGEETRVIPRILALKQM
WSRSSKEKIRLDEAGVTDEVLDSAMQAFLLEIIVKHGEPAPYLCNKDPFA
LKSLTYLSRLFPNAKFLLMVRDGRASVHSMISRKVTIAGFDLNSYRDCLT
KWNRAIETMYNQCMEVGYKKCMLVHYEQLVLHPERWMRTLLKFLQIPWNH
SVLHHEEMIGKAGGVSLSKVERSTDQVIKPVNVGALSKWVGKIPPDVLQD
MAVIAPMLAKLGYDPYANPPNYG

3D structure

• PDB: 5wri Structural basis for the broad substrate specificity of the human tyrosylprotein sulfotransferase-1.
• Chain: B
• Resolution: 1.6 Å

Enzymatic activity

• Enzyme Commision number: 2.8.2.20: protein-tyrosine sulfotransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	B	S117 E120 R123	S54 E57 R60
BS02	peptide	B	P78 E100 R102 R106 P161 F162 K165 V198 T199 I200 A201 F203 A218 R285	P15 E37 R39 R43 P98 F99 K102 V135 T136 I137 A138 F140 A155 R222
BS03	A3P	B	R79 S80 G81 T82 T83 R184 S192 R196 Y239 S286 Q289 V290 K292 P293 N295 K301	R16 S17 G18 T19 T20 R121 S129 R133 Y176 S223 Q226 V227 K229 P230 N232 K238
BS04	MG	B	D90 H92 I95 G276	D27 H29 I32 G213
BS05	ZN	B	H267 E269	H204 E206

Gene Ontology

Molecular Function

• GO:0008476 protein-tyrosine sulfotransferase activity

Biological Process

• GO:0006478 peptidyl-tyrosine sulfation

External links

• PDB: RCSB:5wri, PDBe:5wri, PDBj:5wri
• PDBsum: 5wri
• PubMed: 28821720
• UniProt: O60507|TPST1_HUMAN Protein-tyrosine sulfotransferase 1 (Gene Name=TPST1)