Structure of PDB 5ick Chain B

Receptor sequence

>5ickB (length=229) Species: 9606 (Homo sapiens) [Search protein sequence]

ELTPDQQTLLHFIMDSYNKQRMPQEITNKILKEEFSAEENFLILTEMATN
HVQVLVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNKKLPSG
HSDLLEERIRNSGISDEYITPMFSFYKSIGELKMTQEEYALLTAIVILSP
DRQYIKDREAVEKLQEPLLDVLQKLCKIHQPENPQHFACLLGRLTELRTF
NHHHAEMLMSWRVNDHKFTPLLCEIWDVQ

3D structure

PDB

5ick A Novel Class of Natural FXR Modulators with a Unique Mode of Selective Co-regulator Assembly

Chain

Resolution

2.47 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	B	V299 K303 H313 Q316 I317 K321 L464 E467	V56 K60 H70 Q73 I74 K78 L221 E224
BS02	FEZ	B	M265 P266 T270 M290 N293 H294 S332 I335 F336 L348 I352 F366 Y369	M22 P23 T27 M47 N50 H51 S89 I92 F93 L105 I109 F123 Y126
BS03	FEZ	B	F284 L287 T288 M290 A291 H294 M328 F329 M365 Y369 H447 W454 F461 L465 W469	F41 L44 T45 M47 A48 H51 M85 F86 M122 Y126 H204 W211 F218 L222 W226

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0004879	nuclear receptor activity
GO:0032052	bile acid binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0038183	bile acid signaling pathway

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:5ick, PDBe:5ick, PDBj:5ick
PDBsum	5ick
PubMed	28186695
UniProt	Q96RI1\|NR1H4_HUMAN Bile acid receptor (Gene Name=NR1H4)

[Back to BioLiP]

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417