Structure of PDB 4iqr Chain B

Receptor sequence

>4iqrB (length=308) Species: 9606 (Homo sapiens)

ALCAICGDRATGKHYGASSCDGCKGFFRRSVRKNHMYSCRFSRQCVVDKD
KRNQCRYCRLKKCFRAGMKKEAVQNERDRISTRRSSYEDSSLPSINALLQ
AEVLSDIRAKKIASIADVCESMKEQLLVLVEWAKYIPAFCELPLDDQVAL
LRAHAGEHLLLGATKRSMVFKDVLLLGNDYIVPRHCPELAEMSRVSIRIL
DELVLPFQELQIDDNEYAYLKAIIFFDPDAKGLSDPGKIKRLRSQVQVSL
EDYINDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNL
LQEMLLGG

3D structure

• PDB: 4iqr Multidomain integration in the structure of the HNF-4 alpha nuclear receptor complex.
• Chain: B
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	B	H62 Y63 K72 R76 R80 Q122 E124 R125 R127 S129	H14 Y15 K24 R28 R32 Q74 E76 R77 R79 S81	PDBbind-CN: Kd=80nM
BS02	dna	B	D69 G70 R77 R100 N101 R104 R107 R125 I128	D21 G22 R29 R52 N53 R56 R59 R77 I80	PDBbind-CN: Kd=80nM
BS03	peptide	B	F199 L204 L211 R212 E363	F139 L144 L151 R152 E303
BS04	ZN	B	C51 C71	C3 C23
BS05	ZN	B	C87 C93 C103 C106	C39 C45 C55 C58

Gene Ontology

Molecular Function

• GO:0000978 RNA polymerase II cis-regulatory region sequence-specific DNA binding
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0003707 nuclear steroid receptor activity
• GO:0008270 zinc ion binding
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0006355 regulation of DNA-templated transcription

Cellular Component

• GO:0005634 nucleus

External links

• PDB: RCSB:4iqr, PDBe:4iqr, PDBj:4iqr
• PDBsum: 4iqr
• PubMed: 23485969
• UniProt: P41235|HNF4A_HUMAN Hepatocyte nuclear factor 4-alpha (Gene Name=HNF4A)