Structure of PDB 11bg Chain B

Receptor sequence

>11bgB (length=124) Species: 9913 (Bos taurus)

KESAAAKFERQHMDSGNSPSSSSNYCNLMMCCRKMTQGKCKPVNTFVHES
LADVKAVCSQKKVTCKNGQTNCYQSKSTMRITDCRETGSSKYPNCAYKTT
QVEKHIIVACGGKPSVPVHFDASV

3D structure

• PDB: 11bg A potential allosteric subsite generated by domain swapping in bovine seminal ribonuclease.
• Chain: B
• Resolution: 1.9 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H12 K41 H119 F120 D121
• Catalytic site (residue number reindexed from 1): H12 K41 H119 F120 D121
• Enzyme Commision number: 4.6.1.18: pancreatic ribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	U2G	B	C32 R33	C32 R33
BS02	U2G	B	N44 T45 N67 R85 F120 A122 S123	N44 T45 N67 R85 F120 A122 S123

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0004519 endonuclease activity
• GO:0004522 ribonuclease A activity
• GO:0004540 RNA nuclease activity
• GO:0016829 lyase activity
• GO:0042802 identical protein binding

Biological Process

• GO:0050830 defense response to Gram-positive bacterium
• GO:0051607 defense response to virus

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:11bg, PDBe:11bg, PDBj:11bg
• PDBsum: 11bg
• PubMed: 10543951
• UniProt: P00669|RNS_BOVIN Seminal ribonuclease (Gene Name=SRN)