Structure of PDB 8j9h Chain A1 |
>8j9hA1 (length=137) Species: 3039 (Euglena gracilis) [Search protein sequence] |
PGGGGWSNMVPIIILNGVVWAALGRASLACSPPEFHKRTKNDTEFNKYLH LRFNKAVQNPESVAGQAVKAGCAPEFRPFDSPANPLVVVYGWKDEIQPRP NPGSLAQSFDDRGLSWYQSHFSNRVVDDPKHNSLPFP |
|
PDB | 8j9h Euglena's atypical respiratory chain adapts to the discoidal cristae and flexible metabolism. |
Chain | A1 |
Resolution | 3.11 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
A1 |
F80 L115 |
F79 L114 |
|
|
|