BioLiP

Structure of PDB 4gck Chain A

Receptor sequence

>4gckA (length=190) Species: 507522 (Klebsiella pneumoniae 342) [Search protein sequence]

RNRREEILQSLALMLESSDGSQRITTAKLAASVGVSEAALYRHFPSKTRM
FDSLIEFIEDSLITRINLILKDEKDTTARLRLIVLLILGFGERNPGLTRI
LTGHALMFEQDRLQGRINQLFERIEVQLRQVMREKKMREGEGYTLDETLL
ASQLLAFCEGMLSRFVRSEFKYRPTDDFEARWPLVAAQLQ

3D structure

PDB

4gck SlmA forms a higher-order structure on DNA that inhibits cytokinetic Z-ring formation over the nucleoid.

Chain

Resolution

2.05 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	A	R11 V43 S44 A46 A47 R50	R3 V35 S36 A38 A39 R42	PDBbind-CN: Kd=162.4nM
BS02	dna	A	R31 T33 T34 E45 Y49 S54 K55	R23 T25 T26 E37 Y41 S46 K47	PDBbind-CN: Kd=162.4nM

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0010974	negative regulation of division septum assembly
GO:0051301	cell division
GO:0051302	regulation of cell division

	Cellular Component
GO:0005737	cytoplasm
GO:0009295	nucleoid
GO:0043590	bacterial nucleoid

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

PDB	RCSB:4gck, PDBe:4gck, PDBj:4gck
PDBsum	4gck
PubMed	23754405
UniProt	B5XTG2\|SLMA_KLEP3 Nucleoid occlusion factor SlmA (Gene Name=slmA)