Structure of PDB 3vui Chain A

Receptor sequence

>3vuiA (length=355) Species: 9606 (Homo sapiens)

DNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKK
LSRPFQNQTHAKRAYRELVLMKVVNHKNIIGLLNVFTPQKSLEEFQDVYI
VMELMDANLSQVIQMELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSN
IVVKSDATLKILDFGLARTAGTSTPYVVTRYYRAPEVILGMGYKENVDIW
SVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQLGTPSPEFMKKLQPTVRTY
VENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSKMLVIDASKR
ISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKE
VMDLE

3D structure

• PDB: 3vui Seven cysteine-deficient mutants depict the interplay between thermal and chemical stabilities of individual cysteine residues in mitogen-activated protein kinase c-Jun N-terminal kinase 1
• Chain: A
• Resolution: 2.8 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): D151 K153 N156 D169 T188
• Catalytic site (residue number reindexed from 1): D145 K147 N150 D163 T179
• Enzyme Commision number: 2.7.11.24: mitogen-activated protein kinase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	A	M121 R127 Y130 S161 D162 A163 W324 E329	M115 R121 Y124 S155 D156 A157 W315 E320
BS02	SO4	A	R189 R192	R180 R183
BS03	SO4	A	K153 S155	K147 S149
BS04	SO4	A	R69 R72 R150 R174	R63 R66 R144 R168
BS05	SO4	A	Q37 G38 S58 H66	Q31 G32 S52 H60

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004707 MAP kinase activity
• GO:0005524 ATP binding

Biological Process

• GO:0006468 protein phosphorylation

External links

• PDB: RCSB:3vui, PDBe:3vui, PDBj:3vui
• PDBsum: 3vui
• PubMed: 23020677
• UniProt: P45983|MK08_HUMAN Mitogen-activated protein kinase 8 (Gene Name=MAPK8)