Structure of PDB 1hzx Chain A

Receptor sequence

>1hzxA (length=340) Species: 9913 (Bos taurus) [Search protein sequence]

MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIML
GFPINFLTLYVTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLH
GYFVFGPTGCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGE
NHAIMGVAFTWVMALACAAPPLVGWSRYIPEGMQCSCGIDYYTPHEETNN
ESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAATTQKAEKEVTRMVI
IMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAVYNPVI
YIMMNKQFRNCMVTTLCCGKNPLGDSTTVSKTETSQVAPA

3D structure

PDB

1hzx Advances in determination of a high-resolution three-dimensional structure of rhodopsin, a model of G-protein-coupled receptors (GPCRs).

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	ZN	A	E201 Q279	E201 Q274
BS02	ZN	A	E122 W126 M163 H211	E122 W126 M163 H211
BS03	ZN	A	P267 Y268	P262 Y263
BS04	RET	A	E113 A117 T118 G121 C187 M207 F212 F261 W265 Y268 K296	E113 A117 T118 G121 C187 M207 F212 F256 W260 Y263 K291

Gene Ontology

	Molecular Function
GO:0001965	G-protein alpha-subunit binding
GO:0002046	opsin binding
GO:0004930	G protein-coupled receptor activity
GO:0005085	guanyl-nucleotide exchange factor activity
GO:0005502	11-cis retinal binding
GO:0005515	protein binding
GO:0008020	G protein-coupled photoreceptor activity
GO:0008270	zinc ion binding
GO:0009881	photoreceptor activity
GO:0042802	identical protein binding
GO:0046872	metal ion binding
GO:1990763	arrestin family protein binding

	Biological Process
GO:0000226	microtubule cytoskeleton organization
GO:0007186	G protein-coupled receptor signaling pathway
GO:0007601	visual perception
GO:0007602	phototransduction
GO:0007603	phototransduction, visible light
GO:0009416	response to light stimulus
GO:0009583	detection of light stimulus
GO:0009642	response to light intensity
GO:0010467	gene expression
GO:0016038	absorption of visible light
GO:0016056	G protein-coupled opsin signaling pathway
GO:0043052	thermotaxis
GO:0045494	photoreceptor cell maintenance
GO:0050953	sensory perception of light stimulus
GO:0050960	detection of temperature stimulus involved in thermoception
GO:0060041	retina development in camera-type eye
GO:0071482	cellular response to light stimulus
GO:0071800	podosome assembly
GO:1904389	rod bipolar cell differentiation

	Cellular Component
GO:0000139	Golgi membrane
GO:0001750	photoreceptor outer segment
GO:0001917	photoreceptor inner segment
GO:0005794	Golgi apparatus
GO:0005886	plasma membrane
GO:0005911	cell-cell junction
GO:0016020	membrane
GO:0019867	outer membrane
GO:0042622	photoreceptor outer segment membrane
GO:0042995	cell projection
GO:0060342	photoreceptor inner segment membrane
GO:0097225	sperm midpiece
GO:0097381	photoreceptor disc membrane
GO:0097648	G protein-coupled receptor complex
GO:0120200	rod photoreceptor outer segment
GO:1990913	sperm head plasma membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1hzx, PDBe:1hzx, PDBj:1hzx
PDBsum	1hzx
PubMed	11425302
UniProt	P02699\|OPSD_BOVIN Rhodopsin (Gene Name=RHO)

[Back to BioLiP]

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417