Structure of PDB 1dsw Chain A

Receptor sequence

>1dswA (length=153) Species: 9606 (Homo sapiens) [Search protein sequence]

ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEE
EDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIE
DSVISLSGDHSIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGKIG
KAQ

3D structure

PDB

1dsw The solution structure of a monomeric, reduced form of human copper,zinc superoxide dismutase bearing the same charge as the native protein.

Chain

Resolution

N/A

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H46 H48 H63 H71 H80 D83 H120 R143
Catalytic site (residue number reindexed from 1)	H46 H48 H63 H71 H80 D83 H120 R143
Enzyme Commision number	1.15.1.1: superoxide dismutase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CU	A	H46 H48 H120	H46 H48 H120
BS02	ZN	A	H63 H71 H80 D83	H63 H71 H80 D83

Gene Ontology

	Molecular Function
GO:0004784	superoxide dismutase activity
GO:0005507	copper ion binding
GO:0005515	protein binding
GO:0008270	zinc ion binding
GO:0016209	antioxidant activity
GO:0016491	oxidoreductase activity
GO:0030346	protein phosphatase 2B binding
GO:0031267	small GTPase binding
GO:0042802	identical protein binding
GO:0042803	protein homodimerization activity
GO:0046872	metal ion binding
GO:0051087	protein-folding chaperone binding

	Biological Process
GO:0000302	response to reactive oxygen species
GO:0000303	response to superoxide
GO:0001541	ovarian follicle development
GO:0001819	positive regulation of cytokine production
GO:0001890	placenta development
GO:0001895	retina homeostasis
GO:0002262	myeloid cell homeostasis
GO:0006749	glutathione metabolic process
GO:0006801	superoxide metabolic process
GO:0006879	intracellular iron ion homeostasis
GO:0006915	apoptotic process
GO:0006979	response to oxidative stress
GO:0007283	spermatogenesis
GO:0007566	embryo implantation
GO:0007605	sensory perception of sound
GO:0007626	locomotory behavior
GO:0008089	anterograde axonal transport
GO:0008090	retrograde axonal transport
GO:0008217	regulation of blood pressure
GO:0008340	determination of adult lifespan
GO:0009408	response to heat
GO:0009410	response to xenobiotic stimulus
GO:0010467	gene expression
GO:0019226	transmission of nerve impulse
GO:0019228	neuronal action potential
GO:0019430	removal of superoxide radicals
GO:0032287	peripheral nervous system myelin maintenance
GO:0032930	positive regulation of superoxide anion generation
GO:0033081	regulation of T cell differentiation in thymus
GO:0035234	ectopic germ cell programmed cell death
GO:0040014	regulation of multicellular organism growth
GO:0042542	response to hydrogen peroxide
GO:0042554	superoxide anion generation
GO:0043065	positive regulation of apoptotic process
GO:0043066	negative regulation of apoptotic process
GO:0043087	regulation of GTPase activity
GO:0043410	positive regulation of MAPK cascade
GO:0043524	negative regulation of neuron apoptotic process
GO:0045471	response to ethanol
GO:0046620	regulation of organ growth
GO:0046716	muscle cell cellular homeostasis
GO:0048538	thymus development
GO:0048678	response to axon injury
GO:0050665	hydrogen peroxide biosynthetic process
GO:0050728	negative regulation of inflammatory response
GO:0050766	positive regulation of phagocytosis
GO:0051093	negative regulation of developmental process
GO:0051881	regulation of mitochondrial membrane potential
GO:0060047	heart contraction
GO:0060052	neurofilament cytoskeleton organization
GO:0060087	relaxation of vascular associated smooth muscle
GO:0060088	auditory receptor cell stereocilium organization
GO:0072593	reactive oxygen species metabolic process
GO:0099610	action potential initiation
GO:1902177	positive regulation of oxidative stress-induced intrinsic apoptotic signaling pathway
GO:2000242	negative regulation of reproductive process

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005758	mitochondrial intermembrane space
GO:0005759	mitochondrial matrix
GO:0005777	peroxisome
GO:0005829	cytosol
GO:0005886	plasma membrane
GO:0031410	cytoplasmic vesicle
GO:0032839	dendrite cytoplasm
GO:0032991	protein-containing complex
GO:0043025	neuronal cell body
GO:0070062	extracellular exosome
GO:1904115	axon cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1dsw, PDBe:1dsw, PDBj:1dsw
PDBsum	1dsw
PubMed	10631612
UniProt	P00441\|SODC_HUMAN Superoxide dismutase [Cu-Zn] (Gene Name=SOD1)

[Back to BioLiP]

zhanglab

zhanggroup.org | +65-6601-1241 | Computing 1, 13 Computing Drive, Singapore 117417