Structure of PDB 1bm6 Chain A

Receptor sequence
>1bm6A (length=173) Species: 9606 (Homo sapiens) [Search protein sequence]
FRTFPGIPKWRKTHLTYRIVNYTPDLPKDAVDSAVEKALKVWEEVTPLTF
SRLYEGEADIMISFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDD
DEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLYHSLTDLTRF
RLSQDDINGIQSLYGPPPDSPET
3D structure
PDB1bm6 Solution structure of the catalytic domain of human stromelysin-1 complexed to a potent, nonpeptidic inhibitor.
ChainA
ResolutionN/A
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) H201 E202 H205 H211
Catalytic site (residue number reindexed from 1) H119 E120 H123 H129
Enzyme Commision number 3.4.24.17: stromelysin 1.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN A H201 H205 H211 H119 H123 H129
BS02 ZN A H151 F157 H166 H179 H69 F75 H84 H97
BS03 CA A D158 G159 G161 V163 D181 E184 D76 G77 G79 V81 D99 E102
BS04 CA A D141 G173 N175 G176 D177 D59 G91 N93 G94 D95
BS05 HAV A V163 A165 H201 H205 V81 A83 H119 H123 PDBbind-CN: -logKd/Ki=7.89,Ki=13nM
BS06 MSB A N162 L164 V198 H201 L218 M219 P221 L222 N80 L82 V116 H119 L136 M137 P139 L140 PDBbind-CN: -logKd/Ki=7.89,Ki=13nM
Gene Ontology
Molecular Function
GO:0004222 metalloendopeptidase activity
GO:0008237 metallopeptidase activity
GO:0008270 zinc ion binding
Biological Process
GO:0006508 proteolysis
Cellular Component
GO:0031012 extracellular matrix

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1bm6, PDBe:1bm6, PDBj:1bm6
PDBsum1bm6
PubMed9760240
UniProtP08254|MMP3_HUMAN Stromelysin-1 (Gene Name=MMP3)

[Back to BioLiP]