BioLiP

Structure of PDB 1afl Chain A

Receptor sequence

>1aflA (length=124) Species: 9913 (Bos taurus) [Search protein sequence]

KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHES
LADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTT
QANKHIIVACEGNPYVPVHFDASV

3D structure

PDB

1afl Crystal structures of ribonuclease A complexes with 5'-diphosphoadenosine 3'-phosphate and 5'-diphosphoadenosine 2'-phosphate at 1.7 A resolution.

Chain

Resolution

1.7 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	H12 K41 H119 F120 D121
Catalytic site (residue number reindexed from 1)	H12 K41 H119 F120 D121
Enzyme Commision number	4.6.1.18: pancreatic ribonuclease.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATR	A	K7 H12 C65 N67 Q69 N71 A109 E111 V118 H119	K7 H12 C65 N67 Q69 N71 A109 E111 V118 H119	MOAD: Ki=520nM PDBbind-CN: -logKd/Ki=6.28,Ki=520nM

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0004519	endonuclease activity
GO:0004522	ribonuclease A activity
GO:0004540	RNA nuclease activity
GO:0005515	protein binding
GO:0016829	lyase activity

	Biological Process
GO:0050830	defense response to Gram-positive bacterium

	Cellular Component
GO:0005576	extracellular region

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

PDB	RCSB:1afl, PDBe:1afl, PDBj:1afl
PDBsum	1afl
PubMed	9154942
UniProt	P61823\|RNAS1_BOVIN Ribonuclease pancreatic (Gene Name=RNASE1)