Structure of PDB 1adn Chain A |
>1adnA (length=92) Species: 562 (Escherichia coli) [Search protein sequence] |
MKKATCLTDDQRWQSVLARDPNADGEFVFAVRTTGIFCRPSCRARHALRE NVSFYANASEALAAGFRPCKRCQPDKANPRQHRLDKITHACR |
|
PDB | 1adn Solution structure of the DNA methyl phosphotriester repair domain of Escherichia coli Ada. |
Chain | A |
Resolution | N/A |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
C38 C42 C69 C72 |
Catalytic site (residue number reindexed from 1) |
C38 C42 C69 C72 |
Enzyme Commision number |
2.1.1.63: methylated-DNA--[protein]-cysteine S-methyltransferase. 2.1.1.n11: methylphosphotriester-DNA--[protein]-cysteine S-methyltransferase. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
A |
C38 C42 C72 |
C38 C42 C72 |
|
|
|
|