Structure of PDB 1n8r Chain 3

Receptor sequence
>1n8r3 (length=46) Species: 2238 (Haloarcula marismortui) [Search protein sequence]
GKKSKATKKRLAKLDNQNSRVPAWVMLKTDERNHKRRHWRRNDTDE
3D structure
PDB1n8r Structures of Five Antibiotics Bound at the Peptidyl Transferase Center of the Large Ribosomal Subunit
Chain3
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna 3 G1 K2 K3 K5 A6 K8 K9 R10 L11 K13 Q17 S19 W24 V25 L27 K28 T29 D30 R35 H37 R40 H41 W42 R43 T47 G1 K2 K3 K5 A6 K8 K9 R10 L11 K13 Q17 S19 W24 V25 L27 K28 T29 D30 R32 H34 R37 H38 W39 R40 T44
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1n8r, PDBe:1n8r, PDBj:1n8r
PDBsum1n8r
PubMed12860128
UniProtP22452|RL39_HALMA Large ribosomal subunit protein eL39 (Gene Name=rpl39e)

[Back to BioLiP]