BioLiP

Structure of PDB 5btn Chain D Binding Site BS04

Receptor Information

>5btn Chain D (length=247) Species: 83332 (Mycobacterium tuberculosis H37Rv) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

NALVRRKSGLPGKLADCRSTDPRKSELYVVEGDSAGGSAKSGRDSMFQAI
LPLRGKIINVEKARIDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIV
LMADADVDGQHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDP
EFAYSDRERDGLLEAGLKAGKKINKEDGIQRYKGLGEMDAKELWETTMDP
SVRVLRQVTLDDAAAADELFSILMGEDVDARRSFITRNAKDVRFLDV

Ligand information

>5btn Chain H (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tcatgaatgactatgcacgta

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	5btn Crystal structure and stability of gyrase-fluoroquinolone cleaved complexes from Mycobacterium tuberculosis.
Resolution	2.5 Å
Binding residue (original residue number in PDB)	E459 D461 G483 K484 D536
Binding residue (residue number reindexed from 1)	E31 D33 G55 K56 D108

Enzymatic activity

Enzyme Commision number

5.6.2.2: DNA topoisomerase (ATP-hydrolyzing).

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003918	DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
GO:0005524	ATP binding

	Biological Process
GO:0006265	DNA topological change

View graph for
Molecular Function

View graph for
Biological Process

PDB	RCSB:5btn, PDBe:5btn, PDBj:5btn
PDBsum	5btn
PubMed	26792525
UniProt	P9WG45\|GYRB_MYCTU DNA gyrase subunit B (Gene Name=gyrB)