Structure of PDB 9gd2 Chain E Binding Site BS03

Receptor Information
>9gd2 Chain E (length=93) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
YRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVM
ALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Ligand information
>9gd2 Chain T (length=23) Species: 559292 (Saccharomyces cerevisiae S288C) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
TRFSNRQNKTVNYNIDYSDDDLL
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB9gd2 Resolution of transcription-induced hexasome-nucleosome complexes by Chd1 and FACT.
Resolution4.2 Å
Binding residue
(original residue number in PDB)		Y41 R42 T45 R49 R52 R53 K56
Binding residue
(residue number reindexed from 1)		Y1 R2 T5 R9 R12 R13 K16
External links
PDB RCSB:9gd2, PDBe:9gd2, PDBj:9gd2
PDBsum9gd2
PubMed39270644
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]