BioLiP

Structure of PDB 2ns8 Chain A Binding Site BS03

Receptor Information

>2ns8 Chain A (length=200) Species: 83333 (Escherichia coli K-12) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

RLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALL
DALAIEMLDRHHTHFSPLEGESWQDFLRNNAKSFRNALLSHRDGAKVHLG
TRPTEKQYETLENQLAFLTQQGFSLENALYALSAVGHFTLGSVLEDQEHQ
VAKEERETPTTDSMPPLLRQAIELFDHQGAEPAFLHGLESLIRGFEVQLT

Ligand information

>2ns8 Chain Z (length=4) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

WTWN

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	2ns8 How an agonist peptide mimics the antibiotic tetracycline to induce Tet-repressor
Resolution	2.55 Å
Binding residue (original residue number in PDB)	L25 T26 T27 R28 Q38 Y42 V45 K46 N47 K48
Binding residue (residue number reindexed from 1)	L23 T24 T25 R26 Q36 Y40 V43 K44 N45 K46

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0000976	transcription cis-regulatory region binding
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0046872	metal ion binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0045892	negative regulation of DNA-templated transcription
GO:0046677	response to antibiotic

View graph for
Molecular Function

View graph for
Biological Process

PDB	RCSB:2ns8, PDBe:2ns8, PDBj:2ns8
PDBsum	2ns8
PubMed	17374541
UniProt	P04483\|TETR2_ECOLX Tetracycline repressor protein class B from transposon Tn10 (Gene Name=tetR)