Structure of PDB 8g9u Chain I Binding Site BS02

Receptor Information
>8g9u Chain I (length=124) Species: 486 (Neisseria lactamica) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GLDRNRQDIGYVLGRLFAVLEKIQAEANPGLNATIADRYFGSASSTPIAV
FGTLMRLLPHHLNKLEFEGRAVQLQWEIRQILEHCQRFPNHLNLEQQGLF
AIGYYHETQFLFTKDALKNLFNEA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8g9u Exploiting activation and inactivation mechanisms in type I-C CRISPR-Cas3 for genome-editing applications.
Resolution3.0 Å
Binding residue
(original residue number in PDB)		K23 E27 F68 E69 G70 R71 V73 Q74 R80 F113 K115 K119 F122
Binding residue
(residue number reindexed from 1)		K22 E26 F67 E68 G69 R70 V72 Q73 R79 F112 K114 K118 F121
Enzymatic activity
Enzyme Commision number ?
External links