Structure of PDB 7ux5 Chain I Binding Site BS02

Receptor Information
>7ux5 Chain I (length=116) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQF
VHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMIS
YGGADYKRITVKVNAP
Ligand information
>7ux5 Chain J (length=17) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DPALWQCVFAARYCYEE
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB7ux5 De novo mapping of alpha-helix recognition sites on protein surfaces using unbiased libraries.
Resolution3.35 Å
Binding residue
(original residue number in PDB)		Y56 W57 E58 D61 N63 I65 K75 V76 H78 R113 M115 S117
Binding residue
(residue number reindexed from 1)		Y39 W40 E41 D44 N46 I48 K58 V59 H61 R96 M98 S100
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:7ux5, PDBe:7ux5, PDBj:7ux5
PDBsum7ux5
PubMed36534810
UniProtQ9NZQ7|PD1L1_HUMAN Programmed cell death 1 ligand 1 (Gene Name=CD274)

[Back to BioLiP]