Structure of PDB 4ydv Chain H Binding Site BS02

Receptor Information
>4ydv Chain H (length=220) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QVQLVQSGGGVFKPGGSLRLSCEASGFTFTEYYMTWVRQAPGKGLEWLAY
ISKNGEYSKYSPSSNGRFTISRDNAKNSVFLQLDRLSADDTAVYYCARAD
GLTYFSELLQYIFDLWGQGARVTVSSASTKGPSVFPLAPSGTAALGCLVK
DYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQT
YICNVNHKPSNTKVDKRVEP
Ligand information
>4ydv Chain Q (length=11) Species: 11676 (Human immunodeficiency virus 1) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WGCSGKLICTT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB4ydv Human Non-neutralizing HIV-1 Envelope Monoclonal Antibodies Limit the Number of Founder Viruses during SHIV Mucosal Infection in Rhesus Macaques.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
E31 L98
Binding residue
(residue number reindexed from 1)
E31 L102
Enzymatic activity
Enzyme Commision number ?
External links