Structure of PDB 1aoi Chain G Binding Site BS02

Receptor Information
>1aoi Chain G (length=108) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAE
ILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGRVTIAQGGVLPNI
QSVLLPKK
Ligand information
>1aoi Chain J (length=146) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
atcaatatccacctgcagattctaccaaaagtgtatttggaaactgctcc
atcaaaaggcatgttcagctgaattcagctgaacatgccttttgatggag
cagtttccaaatacacttttggtagaatctgcaggtggatattgat
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1aoi Crystal structure of the nucleosome core particle at 2.8 A resolution.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		A14 T16 R17 R29 R32 R42 R77
Binding residue
(residue number reindexed from 1)		A3 T5 R6 R18 R21 R31 R66
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1aoi, PDBe:1aoi, PDBj:1aoi
PDBsum1aoi
PubMed9305837
UniProtP06897|H2A1_XENLA Histone H2A type 1

[Back to BioLiP]