Structure of PDB 4ez1 Chain E Binding Site BS02

Receptor Information

>4ez1 Chain E (length=202) Species: 6500 (Aplysia californica) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SQANLMRLKSDLFMYPGPTKDDPLTVTLGFTLQDIVKADSSTNEVDLVYY
EQQRWKLNSLMWDPNEYGNITDFRTSAADIWTPDITAYSSTRPVQVLSPQ
IAVVTHDGSVMFIPAQRLSFMCDPTGVDSEEGATCAVKFGSWVYSGFEID
LKTDTDQVDLSSYYASSKYEILSATQTRQVQHYSCCPEPYIDVNLVVKFR
ER

Ligand information

>4ez1 Chain N (length=13) Species: 89438 (Conus bullatus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

GCCSTPPCAVLYC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	4ez1 Pairwise interaction of alpha-conotoxin BuIA Pro6 with the beta subunit of nicotinic acetylcholine receptor
Resolution	2.49 Å
Binding residue (original residue number in PDB)	S146 W147 Y149 Y188 C191 E193 Y195
Binding residue (residue number reindexed from 1)	S141 W142 Y144 Y183 C186 E188 Y190

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0004888	transmembrane signaling receptor activity
GO:0005216	monoatomic ion channel activity
GO:0005230	extracellular ligand-gated monoatomic ion channel activity

	Biological Process
GO:0006811	monoatomic ion transport
GO:0034220	monoatomic ion transmembrane transport

	Cellular Component
GO:0016020	membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4ez1, PDBe:4ez1, PDBj:4ez1
PDBsum	4ez1
PubMed
UniProt	Q8WSF8

[Back to BioLiP]